TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0AFS5|YDGG_ECOLI UPF0118 inner membrane protein ydgG - Escherichia coli
MAKPIITLNGLKIVIMLGMLVIILCGIRFAAEIIVPFILALFIAVILNPLVQHMVRWRVPRVLAVSILMTIIVMAMVLLL
AYLGSALNELTRTLPQYRNSIMTPLQALEPLLQRVGIDVSVDQLAHYIDPNAAMTLLTNLLTQLSNAMSSIFLLLLTVLF
MLLEVPQLPGKFQQMMARPVEGMAAIQRAIDSVSHYLVLKTAISIITGLVAWAMLAALDVRFAFVWGLLAFALNYIPNIG
SVLAAIPPIAQVLVFNGFYEALLVLAGYLLINLVFGNILEPRIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTII
VKIALEQTAGGQSIAVLLSDLNKE