TCDB is operated by the Saier Lab Bioinformatics Group
>P0AG34|RHTB_ECOLI Homoserine/homoserine lactone efflux protein - Escherichia coli.
MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGTLFSRSVIAFEVLKWAGA
AYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNLTNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDII
VMIGYATLAQRIALWIKGPKQMKALNKIFGSLFMLVGALLASARHA