TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1
MQESGGSSGQGGPSLCLEWKQLNYYVPDQEQSNYSFWNECRKKRELRILQDASGHMKTGDLIAILGGSGAGKTTLLAAIS
QRLRGNLTGDVVLNGMAMERHQMTRISSFLPQFEINVKTFTAYEHLYFMSHFKMHRRTTKAEKRQRVADLLLAVGLRDAA
HTRIQQLSGGERKRLSLAEELITDPIFLFCDEPTTGLDSFSAYSVIKTLRHLCTRRRIAKHSLNQVYGEDSFETPSGESS
ASGSGSKSIEMEVVAESHESLLQTMRELPALGVLSNSPNGTHKKAAICSIHQPTSDIFELFTHIILMDGGRIVYQGRTEQ
AAKFFTDLGYELPLNCNPADFYLKTLADKEGKENAGAVLRAKYEHETDGLYSGSWLLARSYSGDYLKHVQNFKKIRWIYQ
VYLLMVRFMTEDLRNIRSGLIAFGFFMITAVTLSLMYSGIGGLTQRTVQDVGGSIFMLSNEMIFTFSYGVTYIFPAALPI
IRREVGEGTYSLSAYYVALVLSFVPVAFFKGYVFLSVIYASIYYTRGFLLYLSMGFLMSLSAVAAVGYGVFLSSLFESDK
MASECAAPFDLIFLIFGGTYMNVDTVPGLKYLSLFFYSNEALMYKFWIDIDNIDCPVNEDHPCIKTGVEVLQQGSYRNAD
YTYWLDCFSLVVVAVIFHIVSFGLVRRYIHRSGYY