TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P16033|PSB2_SYNY3 PHOTOSYSTEM Q(B) PROTEIN (32 KDA THYLAKOID MEMBRANE PROTEIN) (PHOTOSYSTEM II PROTEIN D1) - Synechocystis sp. (strain PCC 6803).
MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADV
LNRANIGFEVMHERNAHNFPLDLASGEQAPVALTAPAVNG