TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P18767|NDVA_RHIME Beta-(1 to 2)glucan export ATP-binding protein NDVA - Rhizobium meliloti (Sinorhizobium meliloti).
MSLFQVYARALQYLAVHKFRVGAIVIANIVLAAITIAEPILFGRIIDAISSQKDVAPMLLLWAGFGVFNTIAFVLVSREA
DRLAHGRRASLLTEAFGRIVSMPLSWHSQRGTSNALHTLLRACETLFGLWLEFMRQHLATAVALMLLIPTAFAMDVRLSL
ILVVLGAAYVMISKVVMSRTKEGQAAVEGHYHTVFSHVSDSISNVSVVHSYNRIEAETRELKKFTQRLLSAQYPVLDWWA
LASGLNRIASTISMMAILVIGTVLVQRGELGVGEVIAFIGFANLLIGRLDQMKAFATQIFEARAKLEDFFQLEDSVQDRE
EPADAGELKGVVGEVEFRDISFDFANSAQGVRNVSFKAKAGQTIAIVGPTGAGKTTLVNLLQRVHEPKHGQILIDGVDIA
TVTRKSLRRSIATVFQDAGLMNRSIGENIRLGREDASLDEVMAAAEAAAASDFIEDRLNGYDTVVGERGNRLSGGERQRV
AIARAILKNAPILVLDEATSALDVETEARVKDAIDALRKDRTTFIIAHRLSTVREADLVIFMDQGRVVEMGGFHELSQSN
GRFAALLRASGILTDEDVRKSLTAA