TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P18790|LTXD_AGGAC Leukotoxin export protein LtxD OS=Aggregatibacter actinomycetemcomitans GN=ltxD PE=1 SV=1
MKTWLLALYDVLSRYKNVWNETWKIRKQLDSPVREKDENEFLPAHLELIETPVSNAPRFVSYSIMLFLTLAIIVSIFSNV
EIIATASGKFALSGRSKEIKPIENSLVKHIFVKEGEYVKKGELLLKLTALGAEADTLKTKTSLSQAKLEEFRYKSLLEAV
EKDQLPILDFSKIDLPFMTENDQKRVTLLIEEQFSTWQKQRHQKTLNLNKKEAEKLSYLARIKKYEGLINTEQVRLDDFR
ALYKEHAIAKHTVLDEENKYQDAINELEVYKASLMQVENEVLLAKEEQELVTQLFKNDILDKLKQATDNVNLLTFELDKN
NQRQQVSEIRAPVSGTVQQLKVHTIDGVVTTAETLMVVVPEEDSLEVTALIQNKDIGFVKEGQEVVIKVEAFPYTRYGYL
TGKVKNITLDAIEHPKLGLVFNTIIELDKKTLSTEEKEIPLSAGMEITAEIKTGMRSVISYLLSPLEESIDKSLRER