TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P20598|ATPZ_BACMQ ATP synthase protein I OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpI PE=3 SV=1
MQDLQHVFPRLRSYILYLLALYVLGWGFTSYKAVFAGLILGTALSLYNLWNLVRKFEQFGQALDEGKKPRSIGTVVRFAT
AALAVVITISYPKTFHIISVVVGLMTYYVVIIIDLVVQNMRRR