TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P28303|DINF_ECOLI DNA-DAMAGE-INDUCIBLE PROTEIN F - Escherichia coli.
MPPGVAVCFSSLFIRLVCMAFLTSSDKALWHLALPMIFSNITVPLLGLVDTAVIGHLDSPVYLGGVAVGATATSFLFMLL
LFLRMSTTGLTAQAYGAKNPQALARTLVQPLLLALGAGALIALLRTPIIDLALHIVGGSEAVLEQARRFLEIRWLSAPAS
LANLVLLGWLLGVQYARAPVILLVVGNILNIVLDVWLVMGLHMNVQGAALATVIAEYATLLIGLLMVRKILKLRGISGEM
LKTAWRGNFRRLLALNRDIMLRSLLLQLCFGAITVLGARLGSDIIAVNAVLMTLLTFTAYALDGFAYAVEAHSGQAYGAR
DGSQLLDVWRAACRQSGIVALLFSVVYLLAGEHIIALLTSLTQIQQLADRYLIWQVILPVVGVWCYLLDGMFIGATRATE
MRNSMAVAAAGFALTLLTLPWLGNHALWLALTVFLALRGLSLAAIWRRHWRNGTWFAAT