TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29705|ATPZ_PROMO ATP synthase protein I, sodium ion specific OS=Propionigenium modestum GN=atpI PE=3 SV=1
MNQEIKKILKNSLITSLIVLVYGIVVRNPIVYFGMFVGCLISTFCFYMICQEAESAMKSGSPFKMTVTGYMKRYAIYGIY
LGILVKFFGFPVFLGGAVGLLNIKFNIFLKVVSTQFEKIKKKLSSLK