TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30145|ALCP_BACP3 SODIUM/PROTON-DEPENDENT ALANINE CARRIER PROTEIN - Bacillus PS3 (Thermophilic bacterium PS-3).
MIRLVTMGKSSEAGVSSFQALTMSLSGRIGVGNVAGTATGIAYGGPGAVFWMWVITFIGAATAYVESTWRKFIKRNKTDN
TVAVRRSTLKKALAGNGLRCSRAAIILSMAVLMPGIQANSIADSFSNAFGIPKLVTGIFVIAVLGFTIFGGVKRIAKTAE
IVVPFMAVGYLFVAIAIIAANIEKVPDVFGLIFKSAFGADQVFGGILGSAVMWGVKRGLYANEAGQGTGAHPAAAAEVSH
PAKQGLVQAFSIYLDVFLVVTATALMILFTGQYNVINEKTGETIVEHLKGVEPGAGYTQAAVDTLFPGFGSAFIAIALFF
FAFTTMYAYYYIAETNLAYLVRSEKRGTAFFALKLVFLAATFYGTVKTATTAWAMGDIGLGIMVWLNLIAILLLFKPAYM
ALKDYEEQLKQGKDPEFNASKYGIKNAKFWENGYKRWEEKKGKAL