TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30329|ARSB_STAAU ARSENICAL PUMP MEMBRANE PROTEIN - Staphylococcus aureus.
MTILAIVIFLLTLTFVIWQPKGLDIGITALIGAVVAIITGVVSLSDVLEVTGIVWNATLTFVAVILISLILDEIGFFEWS
AIHMVKASNGNGLKMFVFIMLLGAIVAAFFANDGAALILTPIVLAMVRNLGFNQKVIFPFIIASGFIADTTSLPLIVSNL
VNIVSADYFDIGFIEYFSRMIIPNIFSLIASILVLWLYFRKSIPKTFDTENLSDPKSAIKDSKLFKLSWIVLAVLLVGYL
VSEFIQIPVSIIAGIIAFIFVILARKSKAVHTKQVIKGAPWNIVVFSIGMYLVVFGLKNVGITTILGDVLTNISNYGLFS
SIMGMGFIAAFLSSIMNNMPTVLIDAIAIGQSSATGILKEGMVYANVIGSDLGPKITPIGSLATLLWLHVLTQKGVKISW
GTYFKTGIIITIPVLFVTLLGLYLTLIIF