TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P32715|MDTO_ECOLI Multidrug resistance protein mdtO OS=Escherichia coli (strain K12) GN=mdtO PE=3 SV=2
MSALNSLPLPVVRLLAFFHEELSERRPGRVPQTVQLWVGCLLVILISMTFEIPFVALSLAVLFYGIQSNAFYTKFVAILF
VVATVLEIGSLFLIYKWSYGEPLIRLIIAGPILMGCMFLMRTHRLGLVFFAVAIVAIYGQTFPAMLDYPEVVVRLTLWCI
VVGLYPTLLMTLIGVLWFPSRAISQMHQALNDRLDDAISHLTDSLAPLPETRIEREALALQKLNVFCLADDANWRTQNAW
WQSCVATVTYIYSTLNRYDPTSFADSQAIIEFRQKLASEINKLQHAVAEGQCWQSDWRISESEAMAARECNLENICQTLL
QLGQMDPNTPPTPAAKPPSMAADAFTNPDYMRYAVKTLLACLICYTFYSGVDWEGIHTCMLTCVIVANPNVGSSYQKMVL
RFGGAFCGAILALLFTLLVMPWLDNIVELLFVLAPIFLLGAWIATSSERSSYIGTQMVVTFALATLENVFGPVYDLVEIR
DRALGIIIGTVVSAVIYTFVWPESEARTLPQKLAGTLGMLSKVMRIPRQQEVTALRTYLQIRIGLHAAFNACEEMCQRVA
LERQLDSEERALLIERSQTVIRQGRDLLHAWDATWNSAQALDNALQPDRAGQFADALEKYAAGLATALSRSPQITLEETP
ASQAILPTLLKQEQHVCQLFARLPDWTAPALTPATEQAQGATQ