TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSO1 PE=1 SV=2
MSYNNPYQLETPFEESYELDEGSSAIGAEGHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQASHLRHSL
DNFVAQATDLQFKLKNEIKSAQRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEV
EAAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQL
DVEQGVGHTDKAVKSARKARKNKIRCWLIVFAIIVVVVVVVVVPAVVKTR