TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P33359|YEHW_ECOLI Putative osmoprotectant uptake system permease protein YehW OS=Escherichia coli (strain K12) GN=yehW PE=1 SV=1
MKMLRDPLFWLIALFVALIFWLPYSQPLFAALFPQLPRPVYQQESFAALALAHFWLVGISSLFAVIIGTGAGIAVTRPWG
AEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIALILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVR
KVELPLAAPVILAGVRTSVIINIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQALSQ
HAK