TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P33410|FIMC_BORPE OUTER MEMBRANE USHER PROTEIN FIMC PRECURSOR - Bordetella pertussis.
MKQIPLILAMSLAFAAAAKGESAPDMQAAVNFDSAMLWGGANGADLSRFNYSNALRPGNYIVDIYANNYPLIRQQVRFVA
AQTSGQGLKTAPAVACFTYGQLEAMQVRLRALDPALVADLKSSGRCEVLGKLFPDSRESFDFGENRLEVSIPQAYTINRF
RRDISPDEWDSGITAFRLGYQYNYADYIGGLRAGRRLDLNLYSGFNFKGWYLRNSSTLGWGQGRFTRRSQRTSLQTDIPS
WRARLVFGDVFSSGEYFAPYSMRGMLVGSDTAMLPYSERLYRPTIRGVARTRANVKVYQAGVLVFQDAVPPGPFAIDDYS
PASYGGDLRVVVTEANGAVQTFTVPYASAVRLILPGQTQWSFSAGRYRNYRNDGQDRPWVTQLTGRHGVADGVNLYGGLL
IAQAYQAGLAGLSWNTPWGAMAADATLSRSQLSTTGNANGSSLRFSYSKTLSGTNTAIRLATLRYSSSGFWNFADAVNAG
PVETNGRNGRFGLYSLLGRERPRGDFSVTLSQPLGGYGSLYVSALRRTYWGSSRVDQQTQLGYSTQVGRVGVNLDVSRTE
NRRSTEHQVMLNLSIPLYGATSSGVVTGSLARTGSAPVQQSVNYSGMSGERDQYTYGLGVQRAGTSAQYALNGSWSGTYG
EVSGQLTHGRSYSQYQINGSGGLVAHAGGVTFGQYQAGTIGLIQAEAAAGAKVVNTRNAAVDRSGYGLVSLTPYSLNEVE
LSPQDLPLDVQLESTVEQVIPRAGAVVALRFPTRHDVAAMLVAEPGSEGALVFGTEVRDGAGKVVGVAGQGASALVRGVS
ASGTLEVTRADGSICRATYDLKSAGQAVHGLPRIALACAPQGGGERGARAAGQAVAQPSAISISGKDHEPDIR