TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P33699|EXOT_RHIME SUCCINOGLYCAN BIOSYNTHESIS TRANSPORT PROTEIN EXOT - Rhizobium meliloti (Sinorhizobium meliloti).
MTPTVNAKTVTRNVGWSVLSKTGTFGLKFVTVPILARILSPEEFGAVAVALTVVQFLAMIGGAGLTSALVIQQHEEMETV
HSVFWANLAIALMMALGLFVFAEPLATLLGAPEAAYLLRIMSLLIPLQLGGDVAYSLLVRRMNFRKDAVWSMISESLGAV
IAVLLALLGFGIWSLLAQLFVSALVRLSGLYAVSRYAPRFVFSLQRVLALSRFSFGMMGSEIANFITFQSPMVVISRYLG
LSDAGAYSAANRFASIPNQVVLSAVMGVLFPTFGQMMHDRERRSQALMLSTQVTTVLLAPMMFGLWALAEPAMLVLFGSQ
WAYAWPVLGLLALSKGILTPCSTFIPYLKGVGQGAVLFWWALIRAVATTGAVAYGAIDGSLVEAMIWLCIVNAVTLVGYS
WVVFRADSTPFLKGLFISSRPMIAALLMALVVRFLLEHFGAHVPNAVLQLIAGTAIGSVIYTVLILLTERSLLRRLLDMA
RARKPRAAPAGAAE