TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P34389|NPC2_CAEEL Niemann-Pick C1 protein homolog 2 OS=Caenorhabditis elegans GN=ncr-2 PE=2 SV=2
MRQGGGGGERMVSVLFLLLIHLALCQAKCVMTECDGEEDSNHPPCKTNKSTYLPITVTRSLNPTYMARFEKYCSYLVQEE
DKAQVCCTELQLKGMTDRISNAATILGSCPSCFDNFAKLWCQFTCSPDQSKFMKVMETTGPKNVVVKMEFKVNRDFVEGL
YESCRHTWFANGLALRLMSLGGKVSFENFYGFMGTKNLAQSIPINTEFQFSRMKNAMNIPTTPCHKSAGPKVPACGAIDC
PTNAHQLVDISKVEHLGTKVFHPHFPDFEWLLKICGCLALTVLLVFILKYSCHRRSAPNGEDGCYVDLGKGNLEVQFEGL
CARYANAVIKHPLIFVSLGLIVAAACCSGNFKFHSLTHSVDQVSAADGETRRNEKKFIHSFGPNHRIEQIFINLPPTTKS
MFNMPLFEEMFQLVGNIQNLTACYGNSSVKLDDICYKPIGKNHGCAIMSPTNYFQNKWTNFENAGPPTIDDEIFDDQHWE
HLKYCIRNPLTVSTYSEMSCFGEFSGPIDPILVFGGSNESIKGAEMYYTARTIMITVLIRGPEDQAIAWETAFLNMMSRY
EMKHANFTFMTETSVAEEIHTAVETDKIVSVIACAAVLIWVITMLGINHWPESSILSALVHHKLLISISAVMISVISVWC
SIGMFSLFGVHATDNAIVVLFFVITCLGINRIFVIIRTFQANGHCYGLPNISYREMNHRISNVMRRSIPIVLTNSLICST
CLFLAGGVLPYVSVSMPAVEVFARHAGLAILMDTAFYLLVMLPLFQYDARREMSGKCEIWPWYELSNESKINLCMEAVDG
NLRSPVDWFKLAIAPLLLKKICRIWIATFFFVSLIIACYCTLCLEFGFNQVMAFSETSYLTKHFQNMNENLNIGPPLWFV
VEGDVKWHDPKMQNKFCTLAGCDDNSMGNKIRSLAYAENYKGNYLHGDVNIWLDSYLQFMHPRGSCCKMDGKQFCDPSNA
THCSSCSSSSVASLTTTEYEFYRNLHHFLETPPSIQCAHGGMALAKPAINLTRNGKIQSAYFSTFFKKLNLSDSIQLYDA
WRFAKYLADDIERELEIPGVKVYVYSTFFPYYEQYLTLSTTVYTLVVLVLFVAFVTISLFLRVNLAGSLVTVFVLLSSYL
HLMEWMYLLGITVNVVSVINMAMSLGIAVEFFGQMLHGFYNSKKPKREERAFAALVSNGSTTLSGIFPAIMITAGCLSFA
DSRVLITYFCNQLVGIGLVCAVHGVVYMPTLLAIFGSDFYQNVSSEEESTDEAELQDTPPSTTSSTSSTSETSV