TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P36051|MCD4_YEAST GPI-anchor biosynthetic protein MCD4 - Saccharomyces cerevisiae (Baker's yeast).
MWNKTRTTLLAVGVLFHLFYLWSIFDIYFISPLVHGMSPYQSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVSGKTEFLA
PFIRSLVMNNATYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQSTHTYSFGSPDILPMFKDGAS
DPNKVDTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDN
VKYIDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNPFPVSDNYTENWELS
SIKRNDVKQADIASLMSYLIGVNYPKNSVGELPIAYIDGKESDKLAALYNNARSILEQYLVKQDEVIDSQFFYKEYFKFV
EKSHSHYLEEIETLIQRISEGENYLEQEAITLTEELMQITLEGLHYLTTYNWRFIRTIVTFGFVGWIFFSFIIFLKSFIL
ENVIDDQKASPLSHAVFGSIGILLNWILFYQHSPFNFYMYLLFPLYFWSYIFTNRSVLRSGIKEFFKGTSPWKRVLITIS
IISVYEGIVYGFFHRWTFTLITNILAFYPFICGVRELSVNILWIITSVLLSTFTLFDAVKIEDLNQIHLAGLLIILSAFY
ALYKIHSRINSYTRAIFAIQISLVAAMLAVTHRSVISLQLRQGLPRESQVAGWIIFFVSLFVMPILHYRKPNNDYKVRLL
IIYLTFAPSFIILTISFESLFYFLFTSYMVQWIEIENKIKEMKTQKDENWLQVLRVSVIGFFLLQVAFFGTGNVASISSF
SLESVCRLLPIFDPFLMGALLMLKLIIPYGLLSTCLGILNLKLNFKDYTISSLIISMSDILSLNFFYLLRTEGSWLDIGI
TISNYCLAILSSLFMLILEVLGHVLLKNVIIQDKTKKTQ