TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37249|PEDC_PEDAC PEDIOCIN PA-1 BIOSYNTHESIS PROTEIN PEDC (PEDIOCIN ACH BIOSYNTHESIS PROTEIN PAPC) - Pediococcus acidilactici.
MSKKFWSNIFLALGVFLAFAGVATISVSADSSATIESNTSSKIIDGATYEENIRGVIPITLTQYLHKAQTGEKFIVFVGF
KECVHCRKFSPVMKQYLQQSQHPIYYLDYGNNGSFSMASQKQITDFYSTFATPMSFMGTPTVALLDNGKVVSMTAGDDTT
LSDLQQITADYNNQ