TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37520|YYAD_BACSU Uncharacterized protein YyaD OS=Bacillus subtilis (strain 168) GN=yyaD PE=4 SV=1
MLWRAGMKWMLLILGSLIGAGYASGQEIWQFFGAESGLAIVLFTIMFIFSSYIVMKISFKVQSTHFLPVLEHLMGPWLAK
IYDVLIIFYLFSTTMVMIAGGGVTLQMYKLPFWWGITLICIVTVCLFLWDVKGILSINSILIPVLVAGLLYALISFQSTH
HHTWTIDLSQQYNWPASITFTSLNILSVVAILSSVGKEMKGLGEAKIASVASGLIFGVISFVYNETLVELAGSLSQFEIP
LFAVLEGAPYFLFLCMTAVLCLAIYTTTVAGLLGLSSRLMAFIHMPRWMIVLILLVLMVPFTSFGFSDLIAFLYPIYGML
NLYLLVCLLLYPILSKWK