TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38043|NRTA_SYNP7 Nitrate transport protein NRTA - Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2).
MSQFSRRKFLLTAGGTAAAALWLNACGSNNSSTDTTGSTSTPAPSGTSGGDAPEVKGVTLGFIALTDAAPVIIALEKGLF
AKYGLPDTKVVKQTSWAVTRDNLELGSDRGGIDGAHILSPMPYLLTAGTITKSQKPLPMYILARLNTQGQGISLSNEFLA
EKVQIKDPKLKAIADQKKASGKLLKAAVTFPGGTHDLWMRYWLAANGIDPNNDADLVVIPPPQMVANMQTGTMDTFCVGE
PWNARLVNKKLGYTAAVTGELWKFHPEKALTIRADWADKNPKATMALLKAVQEAQIWCEDPANLDELCQITAQDKYFKTS
VEDIKPRLQGDIDYGDGRSVKNSDLRMRFWSENASFPYKSHDLWFLTEDIRWGYLPASTDTKALIEKVNRSDLWREAAKA
IGREQDIPASDSRGVETFFDGVTFDPENPQAYLDGLKFKAIKA