TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38101|YFIK_ECOLI Hypothetical protein yfiK - Escherichia coli.
MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAVIDPAAVHLLSWAGA
AYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCW
ALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIFY