TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38279|RTC2_YEAST Protein RTC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1
MKLIPIILNAKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFNVMGAMMQNLLPTMIILAAYY
TLADLILLIQCMWYDKEKKSILQEVKKNVDPVHLPPANPINETVLQDVFNEYEPLLPRIEEEDSQSYSSLELGRTIVVKE
RENFFNDFLIVSGVLIAGILSWYISYCSGLDNGIPKKKPAFEQINLPAQILGYLSAILYLGSRIPQIVLNFKRKSCEGVS
FLFFLFACLGNTSFIISVLSASWLIGSAGTLLMDFTVFIQFFLYAKPKYEKILIDN