TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38325|OM14_YEAST Mitochondrial outer membrane protein OM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OM14 PE=1 SV=1
MSATAKHDSNASPNSDSEDGHHHNNKKECAIEYLKARLNSASAVACGYLQAFVSKTQDFAKVCFLELQNPVVLVNLLLHS
SVVCYLCNGYANHNARFLKGKPNSTVLATTAGALGLLTLDGIISKKYYSRYDKK