TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39165|YCHO_ECOLI Uncharacterized protein YchO OS=Escherichia coli (strain K12) GN=ychO PE=3 SV=3
MSRFVPRIIPFYLLLLVAGGTANAQSTFEQKAANPFDNNNDGLPDLGMAPENHDGEKHFAEIVKDFGETSMNDNGLDTGE
QAKAFALGKVRDALSQQVNQHVESWLSPWGNASVDVKVDNEGHFTGSRGSWFVPLQDNDRYLTWSQLGLTQQDNGLVSNV
GVGQRWARGNWLVGYNTFYDNLLDENLQRAGFGAEAWGEYLRLSANFYQPFAAWHEQTATQEQRMARGYDLTARMRMPFY
QHLNTSVSLEQYFGDRVDLFNSGTGYHNPVALSLGLNYTPVPLVTVTAQHKQGESGENQNNLGLNLNYRFGVPLKKQLSA
GEVAESQSLRGSRYDNPQRNNLPTLEYRQRKTLTVFLATPPWDLKPGETVPLKLQIRSRYGIRQLIWQGDTQILSLTPGA
QANSAEGWTLIMPDWQNGEGASNHWRLSVVVEDNQGQRVSSNEITLTLVEPFDALSNDELRWEP