TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39855|CAPF_STAAU CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN CAPF - Staphylococcus aureus.
MVKNFNYMFVANILSALCKFLILLVIVRLGTPEDVGRYNYALVITAPIFLFISLKIRSVIVTNDKYSPNEYISAILSLNI
ITLIFVAIFVYVLGNGDLTTILIVSLIKLFENIKEVPYGIYQKNESLKLLGISMGIYNILSLILFYIIYSFSHNLNMALL
FLVISCIFSFAIIDRWYLSKYYNIKLHYNNNIAKFKEIFILTIPLAFSSALGSLNTGIPRIVLENLFGKYTLGIFSTIAY
VLVIGGLFANSISQVFLPKLRKLYKDEKKIEFEKLTRKMVFIGIFIGMCSVILSLFLGEALLSLLFGKEYGENNIILIIL
SFGLLFILSGIFLGTTIIATGKYNVNYKISLILLFCILIFSFLLIPKYSLLGAALTITISQFVALISYYYFYKRIF