TCDB is operated by the Saier Lab Bioinformatics Group
>P40100|YE15_YEAST Uncharacterized protein YER185W - Saccharomyces cerevisiae (Baker's yeast).
MSTTDSGFVLYHYTPSKAAAIVFVVLFIIMTVIFAVQTLYAARKSSKALKNNPFESSDDKVDSLEDAEYKQLKITPTVFA
FIPFFTGCIMEAVGYIGRALSSSNPERTTPYIIQSVLLLVAPALIAATIYMIFGRLLHVMRCQSLILISARFGTTFFVVG
DVFSFFLQAAGGGLMSKAGSTKTGSGLITAGLFVQVIFFGFFIINEIRFTVNVKRRCLFYEDISRKWIFVNATLLLSSML
ILLRSIVRIVEFIQGFNGYIISHEYFIYVFDAVPMLLVIIAFSVGSFFGNVFDVIKECQTLSN