TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P41796|EUTH_SALTY Ethanolamine utilization protein eutH (Putative ethanolamine transporter) - Salmonella typhimurium.
MGINEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEGSGGQFEEGFMAMGALGLAMVGMTALAPVLAHVLGPVI
IPVYEMLGANPSMFAGTLLACDMGGFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLA
GIVTIPIGCIAGGLIAMYSGVQINGQPVEFTFALILMNMIPVLIVAVLVALGLKFIPEKMINGFQIFAKFLVALITIGLA
AAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSISCVLLGAYPMVLLLTRWFEKPLMNVGKLLNVNNIAAAGMV
ATLANNIPMFGMMKQMDTRGKVINCAFAVSAAFALGDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKDDAAQV
KTEAEAQS