TCDB is operated by the Saier Lab Bioinformatics Group
>P43111|VEXD_SALTI Vi polysaccharide export inner-membrane protein vexD - Salmonella typhi.
MENSERIKKWKEERAKVAQESRASRLQQKEDERALRQTEKSADAKSHHNPDAGWSATDADSVRRASLVIKERRVQQAKQS
LRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDASQDNFSGTSFFGAGNKMSEGFQVREFILSKEMMDRMEKELG
FLSYFAQDDIALFSRFHAPLGINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQHVNTVSARMQ
KERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKAEYAQLMVNGLDQNPLIPRLS
AKIKVLEKQIGEQRNRLSNKLGSQGSSESLSLFEDLRLQSEIAKARWESALQTLQQGKLQALRERQYLLIISQPMAESDT
TRYADGTKWLLFFVLLGITYLVTSLLITIRRMRE