TCDB is operated by the Saier Lab Bioinformatics Group
>P44658|Y357_HAEIN Putative thiamine biosynthesis protein HI0357 - Haemophilus influenzae.
MKTIIRYFSFVMGLMLTLPSFAKEKISIMLDWYVNPDHAAIIVAQQKGFFEKNNLEVEIIEPADPALPPKLAAAEKVDLA
VSYQPQLYQQVAEGLPLVRVGSLISNPLNSVVVLKKSNLKSLADLKGKKVGYSVSGFEDGLLDTMLHSIGLSNKDVELVN
VNWSLSPSLLTGQVDAVIGAFRNFELNQLALEKQEGIAFFPEQYGVPAYDELILVANKNSVTDKKTSAFLTALEQATSYL
QAHPNEAWQAFVSYKPNELNTPLNQLAWKDTLPFLANKPRQLDAKRYQQMAEFMQQKGLIPKALALKEYAVEIE