TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45546|YHFT_ECOLI Uncharacterized protein yhfT OS=Escherichia coli (strain K12) GN=yhfT PE=4 SV=2
MDLYIQIIVVACLTGMTSLLAHRSAAVFHDGIRPILPQLIEGYMNRREAGSIAFGLSIGFVASVGISFTLKTGLLNAWLL
FLPTDILGVLAINSLMAFGLGAIWGVLILTCLLPVNQLLTALPVDVLGSLGELSSPVVSAFALFPLVAIFYQFGWKQSLI
AAVVVLMTRVVVVRYFPHLNPESIEIFIGMVMLLGIAITHDLRHRDENDIDASGLSVFEERTSRIIKNLPYIAIVGALIA
AVASMKIFAGSEVSIFTLEKAYSAGVTPEQSQTLINQAALAEFMRGLGFVPLIATTALATGVYAVAGFTFVYAVDYLSPN
PMVAAVLGAVVISAEVLLLRSIGKWLGRYPSVRNASDNIRNAMNMLMEVALLVGSIFAAIKMAGYTGFSIAVAIYFLNES
LGRPVQKMAAPVVAVMITGILLNVLYWLGLFVPA