TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45754|GSPA_AERHY General secretion pathway protein A - Aeromonas hydrophila.
MYTQFFGLSEPPFSISPNPKYLYMSERHGEALAHLNYGLQDGGGFVLLTGEVGTGKTTVSRCLLQQLPTETEIAYILNPS
LTERDLLAAICDEFQLPYDKDAGLKLLFDLIRDHLLANLAAGKRSVVLVDEAQHLLPGVLEQLRLLTNLETDEKKLLQVV
LIGQPELQQMLRQPLLRQLAQRITARYHLLPLSHQDVDAYVRFRLQVAGCVQPIFTPKALQTLHRLSGGIPRLINLICDR
ALIAAFARGSHKIVHGDISLAAYEVSGIRDEGTWQSGLMVALAGALLVATGWWGWQFFGFFPERPVIKVEVPVKVDDTPE
QQEQLTRAINQALEPDSAMQNLYKVWGYQTELEEATCDNAPRAGLRCQEGDASLAELQALQHPALISLTDETGGIYYATL
VNLGPDKANLLIGNQSWQVDRQWLSDFWGGSYTLLWRMPKGGVALIGNNAGATQVQWLDNALSRALQQPDRKVRRFDAEL
KNKLQQFQREQGLNPDGIAGSNTLLRLNVMAGEPMPKLEDESQRASTPATPDTMNDEPMVTLSEEAS