TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45755|GSPB_AERHY General secretion pathway protein B - Aeromonas hydrophila.
MSTLLKALRRAEQPQFTPHIPAMGLPVTQEEEQNRRWIWWLLAPLALLMGAGANYGWHLLNNRPIEKTVEVKEVVTPPFV
RVEPRPMITRPLPPPLPEPVVRPRVTPNDSAPAANGSQGLAERIMNALNSTPLMEETAPQAQSESQAMPISALPLELKQR
VPPLAYGSHVFSSNPAKRAVMLNGREFREGSEVAPGVTLIAIAQDYIILQVAGQNVSLKALQDWRG