TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3
MSDSDSKRIDVEAPERVEQHELQVMPVGSTIEVPSLDSTPKLSKRNSSERSLPLRSYSKWSPTEQGATLVWRDLCVYTNV
GGSGQRMKRIINNSTGAIQPGTLMALMGSSGSGKTTLMSTLAFRQPAGTVVQGDILINGRRIGPFMHRISGYVYQDDLFL
GSLTVLEHLNFMAHLRLDRRVSKEERRLIIKELLERTGLLSAAQTRIGSGDDKKVLSGGERKRLAFAVELLNNPVILFCD
EPTTGLDSYSAQQLVATLYELAQKGTTILCTIHQPSSQLFDNFNNVMLLADGRVAFTGSPQHALSFFANHGYYCPEAYNP
ADFLIGVLATDPGYEQASQRSAQHLCDQFAVSSAAKQRDMLVNLEIHMAQSGNFPFDTEVESFRGVAWYKRFHVVWLRAS
LTLLRDPTIQWLRFIQKIAMAFIIGACFAGTTEPSQLGVQAVQGALFIMISENTYHPMYSVLNLFPQGFPLFMRETRSGL
YSTGQYYAANILALLPGMIIEPLIFVIICYWLTGLRSTFYAFGVTAMCVVLVMNVATACGCFFSTAFNSVPLAMAYLVPL
DYIFMITSGIFIQVNSLPVAFWWTQFLSWMLYANEAMTAAQWSGVQNITCFQESADLPCFHTGQDVLDKYSFNESNVYRN
LLAMVGLYFGFHLLGYYCLWRRARKL