TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P46720|OATP_RAT SODIUM-INDEPENDENT ORGANIC ANION TRANSPORTER (ORGANIC ANION TRANSPORTING POLYPEPTIDE) - Rattus norvegicus (Rat).
MEETEKKIATQEGRLFSKMKVFLLSLTCACLTKSLSGVYMNSMLTQIERQFDISTSVAGLINGSFEIGNLFFIVFVSYFG
TKLHRPVVIGIGCVIMGLGCLLMSLPHFFMGRYEYETTISPTGNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIC
VMVGNIIRGIGETPIVPLGISYIEDFAKSENSPLYIGILEMGKVAGPIFGLLLGSYCAQIYVDIGSVNTDDLTITPSDTR
WVGAWWIGFLVCAGVNILTSIPFFFLPKALPKKGQQENVAVTKDGKVEKYGGQAREENLGITKDFLTFMKRLFCNPIYML
FILTSVLQVNGFINKFTFLPKYLEQQYGKSTAEAIFLIGVYSLPPICLGYLIGGFIMKKFKITVKKAAYLAFCLSVFEYL
LFLCHFMLTCDNAAVAGLTTSYKGVQHQLHVESKVLADCNTRCSCSTNTWDPVCGDNGVAYMSACLAGCKKFVGTGTNMV
FQDCSCIQSLGNSSAVLGLCKKGPECANRLQYFLILTIIISFIYSLTAIPGYMVFLRCVKSEEKSLGVGLHTFCIRVFAG
IPAPVYFGALIDRTCLHWGTLKCGQRGACRMYDINSFRHIYLGLPIALRGSSYLPAFFILILMRKFQFPGDIDSSATDHT
EMMLGEKESEHTDVHGSPQVENDGELKTKL