TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P47114|YJ24_YEAST Uncharacterized vacuolar membrane protein YJR054W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR054W PE=1 SV=1
MFNHDWKYSINSKTFADLNIELFRNHKFKTVLNYIIGVVGWNGLKLALFVSDIYTCIKLLAFNSWSNNIIKPYLPFKISK
WLFSGCILASIVLLIWEAIAGMRIYKTGNISLTYVNNFSRNLNSVLNYSKFCVYNMIERKGFRQKMTFFTFFQLKDCIRL
IFTDTPRQVINGLTLWSVLVTVNKNEDLGDLESFTGLINKIKNIGQTNHEEAVILSLMLFSFIIWALFVFKFLLAVICSI
FVYYKIINDQEYSGLREYICVTVSENVDELVERQRKKENDDTIYKTGLLESQTFDDFKEVENKIETSFNDTSYASNNDSM
IELIERRPEYKSQDVCGPIPTMKKTETMESFVDNGNPQYTTRFSAILDSPYINSYESNDIKKAKIQSRSVNTPKYEDLSS
SDIFNKIHSAGQLKSTTSMEFHGPLDSMPNTTNNIRNFNSNSSRPRPPPLQTKSSINSKADSNDNGRIYTPMKAYFREPD
LPRKGLLEDEDRTYNYT