TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P50487|YCPX_CLOPE HYPOTHETICAL PROTEIN IN CPE 5'REGION (FRAGMENT) - Clostridium perfringens.
MEKQNLKNTEVNLIYGVDDDLDLPKKVLFGLQHIFAAFGGIIVVPLVIATSLGFDSKVTTALISASILGSGLATIIQAKG
VGKVGARVACIMGTDFTFVSPAISVGSVLGLPGIIGATILGSLFEVILSFFIKPLMKFFPPLVTGTVVALIGLTLLPVSI
DWAAGGAGSANYASLENLAVAMFVLVITLLLNNYGKGMISSASILIGIVVGYIVCIPLGLVDFTPVKEASWLSFPKILEF
GVTFDAKAVMAFIPAYFVATIGTVGCLKAIGETSNIDIGDKRVAAGVLSDGVGSALGGLVGSCPNTSFSQNIGIISLTKV
ASRHVAVMAGILLVILGFLPKVAAIITGIPNPVLGGVGIMMFGTVAAAGIRTLSNIKLTERNLLIIAISMGLGLGVTFRP
DVIHNLPEAIRMIFSSGISTGTIAALILNAVLKESPTSMEFENMYDEEKKAS