TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P50726|YPAA_BACSU Hypothetical protein ypaA - Bacillus subtilis.
MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIAILIYGPLAGIAVEAIKNVLQYIIQGSMAGVPVGQV
ANFIAGTLFILPTAFLFKKLNSAKGLAVSLLLGTAAMTILMSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNM
IKGIVITVVFSLIFIKLKPWIEQQRSAHIH