TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1
MVTNNGDGEHLGIRRNGNLRHPSNNMKIPRRAQSTVLNSNPFYSRKYSMSTLTPRDICRSVDSRVFVDMSSPNFQTLEDP
HRDEIINSVRLNYLNSSKRSSVSHGNEAIPRVNPTKNSSASTIAAANVDSDDDETNLSSAGGDITHDIYKLVKAEDPKRL
RRPRSMENVTPKIEHHTKLSSASGLNVPGGFRREFIVNKKRQEHQLNDSASSDFTSHESDSINQSSPSSNQDIDKVPFLT
RNFLEFLYVFGHFAGESFEDDFIPDSSNMMIRGEDERSALLSRPDHMKVLPSAKGTTSTKKVFLILLKSFIGTGVLFLPN
AFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQ
AFLDNVFHVGVLPLSYLMVFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLMGTPAMGVVYGLN
ADRWTLFIGTAIFAFEGIGLIIPVQDSMRNPEKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVN
LIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVSIAY
FGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPMLDTILIFFGIASMLYTSYQSIFGV