TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P51000|DPPC_HAEIN Dipeptide transport system permease protein dppC OS=Haemophilus influenzae GN=dppC PE=3 SV=1
MSDTPLTFAPKTPLQEFWFYFKQNRGALIGLIFILIVALISILAPYIAPFDPTEQNRTALLLPPAWYEGGNPAYLLGTDD
IGRDILSRIIYGTRISVFAGFIIVLLSCAFGTSLGLISGYYGGVLDTIIIRLIDIMLAIPNLLLTIVVVSILEPSLANAT
LAIAVVSIPSYVRLTRAAMMNEKNRDYVTSSKVAGAGILRLMFIVILPNCLAPLIVQMTMGISNAILELATLGFLGIGAK
PPTPELGTMLSEARGFMQAANWLVTIPGLVILSLVLAFNLMGDGLRDALDPKLKQ