TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P53431|Y1138_MYCLE Uncharacterized protein ML1138 OS=Mycobacterium leprae (strain TN) GN=ML1138 PE=4 SV=1
MTTPAQDAPLVLPAVAFRPVRLFIINIVLTGLAMLAAGLSGHLMVGVFFGIGLLLGLLNALLVRCSVESITAQGHPLKRS
MALNSASRLAIITVFGLIIAYAFPLAGLGVVFGLALFQVLLVLSTMLPVWRKFRFGEADGGVLKGSEGEEQQR