TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P56557|TM50B_HUMAN Transmembrane protein 50B OS=Homo sapiens GN=TMEM50B PE=1 SV=2
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQV
RGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT