TCDB is operated by the Saier Lab Bioinformatics Group
>P60682|MNHC_STAAU Na(+)/H(+) antiporter subunit C - Staphylococcus aureus.
MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIA
FATTAFFLVLAFRTYKELGTDNVESMKGVPEDD