TCDB is operated by the Saier Lab Bioinformatics Group
>P60694|MNHF_STAAU Na(+)/H(+) antiporter subunit F - Staphylococcus aureus.
MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFS
KFMDKGKVIEHDQNHTD