TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P66771|Y1280_MYCTU Uncharacterized protein Rv1280c/MT1317 OS=Mycobacterium tuberculosis GN=Rv1280c PE=3 SV=1
MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLELAPTADRRAAVGTTSDINQQ
DPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKATLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINP
EAVWSDGTPITWRDIASQIHAISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA
TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAARLPALQNNTIDATGVGTLDQL
TIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLAIAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDN
SGVVAYNPEQAKRELDALGWRRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN
VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARALANQVDELIWAEGFSLPLTQS
PGTVAVRSTLANFGATGLADLDYTAIGFMRR