TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P66964|Y1282_MYCTU Putative peptide transport permease protein Rv1282c/MT1319 OS=Mycobacterium tuberculosis GN=Rv1282c PE=3 SV=1
MTEFASRRTLVVRRFLRNRAAVASLAALLLLFVSAYALPPLLPYSYDDLDFNALLQPPGTKHWLGTNALGQDLLAQTLRG
MQKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWVVDLLLVVPSFILIAIVTPRTKNSANIMFLVLLLAGFGWMI
SSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNVASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLI
ADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR