TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P66966|Y1283_MYCTU Putative peptide transport permease protein Rv1283c/MT1320 OS=Mycobacterium tuberculosis GN=Rv1283c PE=3 SV=1
MTRYLARRLLNYLVLLALASFLTYCLTSLAFSPLESLMQRSPRPPQAVIDAKAHDLGLDRPILARYANWVSHAVRGDFGT
TITGQPVGTELGRRIGVSLRLLVVGSVFGTVAGVVIGAWGAIRQYRLSDRVMTTLALLVLSTPTFVVANLLILGALRVNW
AVGIQLFDYTGETSPGVAGGVWDRLGDRLQHLILPSLTLALAAAAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLK
HGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFSGAVVLLAGLLSDVIYAALDP
RVRVS