TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P72958|Y640_SYNY3 Hypothetical 66.7 kDa protein SLL0640 - Synechocystis sp. (strain PCC 6803).
MAFLQTWLADYQIPLTLAVIVFALVMFVLEWLPIDTTAILVAVILMVLGLVTPTEGIAGFSNSATVTIMAMFILSYGITR
TGIIQIIRDSLIKFGGDSLRRQLLLMGFIVGPSSAFLNNTAIVAIFLPIIEEWARQRQISVSKLLIPLSYATILGGMITL
LGTSTNILASGLAEKLTGQGFSIFQFTPLGLLTFSVGLIYIVLAAPILLPARRNISDGNVAAEYQIKDYVSEIIIPPRSS
LIGQTLRQSEIQRKFDIDVLEIIHNDTHFPQPLADRVLTMGDILLVRAGREDLLRIKDERGIEILADVQFVSAETNNAGP
LESSEEKVAEVLILSNSRLIGSTLKDLRFRQRYNATVIAIRRGEELIRQRLGKVRLKFGDLLLLQGPRESFLGLQTTREL
LVLEEKPLDNLRLDKAKTAIAIVALVIVIAGLDILPISVTSWAGVMAMVISGCLKPGEIYGAIRWDVIFLLAGLIPLGTA
MENSGTTAWFASFLADAGGHLSGYALLLLFYLATALLTEILSNNATVVLMLPIAFQVAQSLGLNPLAFMFVVTFAASNSF
MSPIGYQTNTMVYGPGGYRFTDFARIGAPLTVILTLATPLLVMLIYGVQPTN