TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P75788|YBIR_ECOLI Inner membrane protein YbiR OS=Escherichia coli (strain K12) GN=ybiR PE=1 SV=1
MSLPFLRTLQGDRFFQLLILVGIGLSFFVPFAPKSWPAAIDWHTIITLSGLMLLTKGVELSGYFDVLGRKMVRRFATERR
LAMFMVLAAALLSTFLTNDVALFIVVPLTITLKRLCEIPVNRLIIFEALAVNAGSLLTPIGNPQNILIWGRSGLSFAGFI
AQMAPLAGAMMLTLLLLCWCCFPGKAMQYHTGVQTPEWKPRLVWSCLGLYIVFLTALEFKQELWGLVIVAAGFALLARRV
VLSVDWTLLLVFMAMFIDVHLLTQLPALQGVLGNVSHLSEPGLWLTAIGLSQVISNVPSTILLLNYVPPSLLLVWAVNVG
GFGLLPGSLANLIALRMANDRRIWWRFHLYSIPMLLWAALVGYVLLVILPAN