TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76017|YCGV_ECOLI Uncharacterized protein YcgV OS=Escherichia coli (strain K12) GN=ycgV PE=3 SV=1
MGIKQHNGNTKADRLAELKIRSPSIQLIKFGAIGLNAIIFSPLLIAADTGSQYGTNITINDGDRITGDTADPSGNLYGVM
TPAGNTPGNINLGNDVTVNVNDASGYAKGIIIQGKNSSLTANRLTVDVVGQTSAIGINLIGDYTHADLGTGSTIKSNDDG
IIIGHSSTLTATQFTIENSNGIGLTINDYGTSVDLGSGSKITTDGSTGVYIGGLNGNNANGAARFTATDLTIDVQGYSAM
GINVQKNSVVDLGTNSTIKTNGDNAHGLWSFGQVSANALTVDVTGAAANGVEVRGGTTTIGADSHISSAQGGGLVTSGSD
AIINFTGTAAQRNSIFSGGSYGASAQTATAVVNMQNTDITVDRNGSLALGLWALSGGRITGDSLAITGAAGARGIYAMTN
SQIDLTSDLVIDMSTPDQMAIATQHDDGYAASRINASGRMLINGSVLSKGGLINLDMHPGSVWTGSSLSDNVNGGKLDVA
MNNSVWNVTSNSNLDTLALSHSTVDFASHGSTAGTFATLNVENLSGNSTFIMRADVVGEGNGVNNKGDLLNISGSSAGNH
VLAIRNQGSEATTGNEVLTVVKTTDGAASFSASSQVELGGYLYDVRKNGTNWELYASGTVPEPTPNPEPTPAPAQPPIVN
PDPTPEPAPTPKPTTTADAGGNYLNVGYLLNYVENRTLMQRMGDLRNQSKDGNIWLRSYGGSLDSFASGKLSGFDMGYSG
IQFGGDKRLSDVMPLYVGLYIGSTHASPDYSGGDGTARSDYMGMYASYMAQNGFYSDLVIKASRQKNSFHVLDSQNNGVN
ANGTANGMSISLEAGQRFNLSPTGYGFYIEPQTQLTYSHQNEMTMKASNGLNIHLNHYESLLGRASMILGYDITAGNSQL
NVYVKTGAIREFSGDTEYLLNNSREKYSFKGNGWNNGVGVSAQYNKQHTFYLEADYTQGNLFDQKQVNGGYRFSF